Nigeria Meat & Poultry Market (2026-2032) | Size, Growth, Revenue, Companies, Industry, Share, Value, Analysis, Outlook, Trends, Forecast

Market Forecast By Poultry Type (Chicken, Turkey, Ducks, Others), By Meat Type (Pork, Mutton, Processed Beef, Others), By End-Users (Retail, Food-Services) And Competitive Landscape
Product Code: ETC015789 Publication Date: Oct 2020 Updated Date: Jun 2026 Product Type: Report
Publisher: 6Wresearch Author: Ravi Bhandari No. of Pages: 70 No. of Figures: 35 No. of Tables: 5

NigeriaMeat&PoultryMarketSummary

Thenigeriameat&poultrymarketwasestimatedatUSD253Millionin2025andisprojectedtoreachUSD343Millionby2032,growingataCAGRof5.0%from2026to2032.

NigeriaMeat&PoultryMarketGrowthRateAnalysis(2021-2032)

TheNigeriaMeat&PoultryMarketexhibitedstablegrowthoverthepastyears,withannualincreasesof5.6%in2021,slightlytaperingto5.1%in2022,beforereboundingto5.4%in2023.Thisresiliencecanbeattributedtorisingconsumerdemandfueledbypopulationgrowthandurbanization.Investmentinmodernfarmingtechniquesandinfrastructurehasalsoplayedacrucialroleinenhancingproductionefficiencies.Thegrowthrateisexpectedtostabilizeataround5.0%through2025,asthemarketadaptstopost-pandemicrecoveryandongoingdigitalizationefforts.However,fluctuatingenergypricesandevolvingconsumerpreferencesmayinfluencefuturetrends,slightlyalteringgrowthprojectionsinthecomingyears.

NigeriaMeat&PoultryMarketYear-wiseGrowthRateandKeyDrivers

ThisgraphhighlightshowtheNigeriaMeat&PoultryMarkethassteadilygrownoverthepastfiveyears,supportedbymajorgrowthfactors.

Thetablebelowpresentstheyear wisegrowthratesalongwiththekeydriversinfluencingthemarket

Note-Marketsizeestimationsandgrowthprojectionspresentedinthisreportarebasedon6Wresearch'sadvancedforecastingapproach,validatedwithindustrydatasetsasofJune2026.

NigeriaMeat&PoultryMarketSynopsis

TheNigeriaMeat&PoultryMarketisprojectedtoreach5.3%andwitnesssignificantgrowthduringtheforecastperiod(2026-2032).Thisindustryispredominantlyinfluencedbyaburgeoningpopulation,increasingurbanization,andevolvingdietarypreferencesamongconsumers.TheprimarysourcesofmeatinNigeriaincludebeef,poultry,andgoatmeat,withpoultryleadingthemarketduetoitsaffordabilityandculinaryflexibility.Whilelocalproductionfulfillsalargeshareofthedemand,importsremainacrucialcomponentinbalancingconsumerneeds.Themarketcontendswithchallengessuchasinadequateinfrastructure,unreliablesupplychainlogistics,andlivestockdiseasesthatdisruptproduction.Inresponse,variousinitiativesaimedatboostingproductionefficiency,enforcingfoodsafetyprotocols,andimprovingmarketaccessibilityarebeingintroduced,highlightingapromisingoutlookforbothdomesticandforeignstakeholders.

NigeriaMeat&PoultryMarketGrowthDrivers

TheNigeriaMeat&PoultryMarketispropelledbyseveralkeydriversthatindicateapositivegrowthtrajectory.Firstly,thenation'srapidlygrowingpopulationnotonlyincreasesdemandformeatbutalsoshiftsdietaryhabitstowardsprotein-richfoods.Secondly,urbanizationtrendscontributetotherisingneedforaccessibleandconvenientmeatproducts,furtherenhancingmarketpotential.Thirdly,anoticeableconsumershifttowardsprocessedandpackagedmeatreflectschanginglifestylesthatfavorconvenienceandhygiene.Additionally,heightenedhealthawarenessdrivesdemandfororganicandantibiotic-freemeatalternatives.Finally,theproliferationofe-commerceplatformsandonlinegroceryservicesallowsgreateraccesstoavarietyofmeatproducts,effectivelyboostingsalesandmarketreach.

NigeriaMeat&PoultryMarketTrendsandOpportunities

Inthecurrentlandscape,theNigeriaMeat&PoultryMarketexhibitsseveralnotabletrends.Thereisanincreasingconsumerpreferenceforhygienicallyprocessedandpackagedmeats,aligningwithcontemporarylifestylesfocusedonconvenience.Anothersignificanttrendistheshifttowardsorganicandantibiotic-freemeatproducts,reflectingagrowinghealthconsciousnessamongconsumers.Furthermore,asurbanizationaccelerates,thedemandforready-to-eatmealsandvalue-addedmeatproductsisontherise.Thisshiftpresentsopportunitiesforinnovationandmarketexpansion,particularlyforproducerswhocanadapttoconsumerpreferences.Additionally,theicecreaminfrastructuredevelopmentforcoldstorageandtransportationisvitaltoreducingspoilageandenhancingproductavailability,addressingacriticalbarriertogrowth.

NigeriaMeat&PoultryMarketChallengesandRestraints

Despiteitsgrowthpotential,theNigeriaMeat&PoultryMarketfacesseveralchallenges.Inadequateinfrastructurefortransportationandstorageremainsasignificanthurdle,leadingtoproductspoilageandlossofquality.Additionally,supplychaininconsistenciesoftencausedelaysandinefficiencies,adverselyimpactingoverallmarketperformance.Highproductioncostslinkedtofluctuatingfeedpricesandrisingenergycostsalsoposebarrierstoprofitabilityforproducers.Furthermore,regulatoryissues,particularlyregardingenforcementandcompliance,hindermarketcompetitiveness,allowingunregulatedimportsandsmugglingtoflourish.Lastly,diseaseoutbreaksamonglivestocksignificantlythreatenproductioncapability,urgingtheneedforimprovedhealthmanagementandbiosecuritymeasures.

NigeriaMeat&PoultryMarketInvestmentOpportunities

InvestmentopportunitiesaboundwithintheNigeriaMeat&PoultryMarket,primarilyinexpandingpoultryproductioncapabilitiestosatisfythegrowingdemandforchickenandeggs.Thereisamplescopeforenhancingprocessingtechnologiesandequipment,whichwouldsignificantlyimproveoperationalefficienciesandproductstandards.Moreover,investinginrobustcoldchaininfrastructureaddressesessentialstorageanddistributionneeds,minimizingfoodspoilage.Thedevelopmentofvalue-addedproducts,suchasprocessedmeatsandquick-preparationmeals,isanotherpromisingareaforinvestorsseekingtotapintochangingconsumerlifestyles.Ultimately,strategicinvestmentsfocusingonproduction,processing,anddistributioncanharnesstheexpandingpotentialoftheNigeriaMeat&PoultryMarket.

NigeriaMeat&PoultryMarketGovernmentInvestmentandInitiatives

TheNigeriaMeat&PoultryMarketbenefitsfromvariousgovernmentpoliciesdesignedtoensurefoodsafetyandindustryregulation.TheimplementationoftheLivestockIdentificationandTraceabilitySystemisacrucialsteptowardsenhancingsupplychaintransparencyandqualityassurance.Furthermore,thegovernmenthasadoptedstrictimportrestrictionsandtariffstoprotectlocalproducers,aimingtofosterself-sufficiencywithinthesector.Regulatorybodies,suchastheNationalAgencyforFoodandDrugAdministrationandControl(NAFDAC),areactivelyinvolvedinoverseeingthequalityandsafetyofmeatproductsthroughstringentprocessing,packaging,andlabelingstandards.Additionally,governmentinitiativesfocusonprovidingsupportandincentivesforlocalproducerstoenhancetheircompetitivenessandsustainabilityinthemarket.

NigeriaMeat&PoultryMarketLatestDevelopments(May2025-June2026)

IntheperiodfromMay2025toJune2026,significantdevelopmentshaveoccurredwithintheNigeriaMeat&PoultryMarket,indicatingarobustindustrydirection.Initiativespromotinglocalproductionaregainingtraction,withvariousprogramsaimedatboostingpoultryfarmingandlivestockmanagementpractices.Furthermore,advancementsintechnologyarebeingintegratedintothesupplychain,enhancingtheefficiencyandsafetyofmeatprocessinganddistribution.Additionally,themarkethasseenincreasedinvestmentsincoldchainlogistics,addressingpreviousconcernsoverproductspoilageandqualitycontrol.Consumerdemandforhealthierandmoreethicallysourcedmeatcontinuestoshapeproductofferings,leadingtoasurgeintheavailabilityoforganicandantibiotic-freeoptions.

NigeriaMeat&PoultryMarket-KeyAttractivenessoftheReport

  • 10YearsofMarketNumbers
  • HistoricalDataStartingfrom2022to2025
  • BaseYear:2025
  • ForecastDatauntil2032
  • KeyPerformanceIndicatorsImpactingtheMarket
  • MajorUpcomingDevelopmentsandProjects
Thegrowthislargelydrivenbyagrowingpopulation,urbanization,increasingdemandforprotein-richfoods,andchangingconsumerpreferencestowardsconvenienceandquality. WhataretheprimarychallengesfacingtheNigeriaMeat&PoultryMarket? Challengesincludeinadequateinfrastructure,inconsistentsupplychains,highproductioncosts,anddiseaseoutbreaksaffectinglivestock,allofwhichhindermarketefficiencyandgrowth. Whatinvestmentopportunitiesexistinthismarket? Opportunitiesincludeexpandingpoultryproduction,investinginmodernprocessingtechnologies,developingcoldchaininfrastructure,andcreatingvalue-addedmeatproducts. HowisthegovernmentsupportingtheNigeriaMeat&PoultryMarket? Thegovernmentimplementsregulationstoensurefoodsafety,promoteslocalproductionthroughtariffsonimports,andsupportsinitiativesforenhancedlivestockmanagementandmarketaccess.

Key Highlights of the Report:

  • Nigeria Meat & Poultry Market Outlook
  • Market Size of Nigeria Meat & Poultry Market, 2025
  • Forecast of Nigeria Meat & Poultry Market, 2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Revenues & Volume for the Period 2022-2032F
  • Nigeria Meat & Poultry Market Trend Evolution
  • Nigeria Meat & Poultry Market Drivers and Challenges
  • Nigeria Meat & Poultry Price Trends
  • Nigeria Meat & Poultry Porter's Five Forces
  • Nigeria Meat & Poultry Industry Life Cycle
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Poultry Type for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Chicken for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Turkey for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Ducks? for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Others for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Meat Type for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Pork for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Mutton for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Processed Beef for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Others for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By End-Users for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Retail for the Period 2022-2032F
  • Historical Data and Forecast of Nigeria Meat & Poultry Market Revenues & Volume By Food-Services for the Period 2022-2032F
  • Nigeria Meat & Poultry Import Export Trade Statistics
  • Market Opportunity Assessment By Poultry Type
  • Market Opportunity Assessment By Meat Type
  • Market Opportunity Assessment By End-Users
  • Nigeria Meat & Poultry Top Companies Market Share
  • Nigeria Meat & Poultry Competitive Benchmarking By Technical and Operational Parameters
  • Nigeria Meat & Poultry Company Profiles
  • Nigeria Meat & Poultry Key Strategic Recommendations

Frequently Asked Questions About the Market Study (FAQs):

The growth is largely driven by a growing population, urbanization, increasing demand for protein-rich foods, and changing consumer preferences towards convenience and quality.
Challenges include inadequate infrastructure, inconsistent supply chains, high production costs, and disease outbreaks affecting livestock, all of which hinder market efficiency and growth.
6Wresearch actively monitors the Nigeria Meat & Poultry Market and publishes its comprehensive annual report, highlighting emerging trends, growth drivers, revenue analysis, and forecast outlook. Our insights help businesses to make data-backed strategic decisions with ongoing market dynamics. Our analysts track relevent industries related to the Nigeria Meat & Poultry Market, allowing our clients with actionable intelligence and reliable forecasts tailored to emerging regional needs.
Yes, we provide customisation as per your requirements. To learn more, feel free to contact us on sales@6wresearch.com
YearGrowthRateMajorDrivers
20215.6%Poultryproductionfacedchallengeswithavianinfluenzaimpactingsupplychainssignificantly.
20225.1%Consumerpreferenceshiftedtowardslocallysourcedmeatproductsamidsteconomicuncertainties.
20235.4%Innovativefarmingtechniquesbeganenhancingpoultryyield,gainingtractionamongsmallholders.
20245.2%Urbanizationtrendsspurredthedemandforconvenient,ready-to-eatmeatproducts.
20255.0%Health-consciousconsumersincreasinglysoughtorganicandfree-rangemeatoptions.
20265.0%Emergingdigitalplatformstransformedmeatdistributionchannelsandconsumerengagementstrategies.
20275.0%Investmentinagritechstartupsstartedimprovingoperationalefficienciesacrossthesector.
20285.1%MeatexportpotentialexpandedwithincreasedglobalinterestinNigerianpoultryproducts.
20295.2%Risingpopulationdensityincitiesfueledhigherconsumptionratesofpoultryandmeat.
20305.5%Supplychaininnovationsemphasizeddirectfarm-to-consumersales,enhancingfreshnessperception.
20315.4%Sustainabilityinitiativesgainedmomentum,influencingconsumerchoicestowardsethicallysourcedmeat.
20325.3%Collaborationsbetweenlocalfarmersandrestaurantsshowcasedthequalityofdomesticproduce.

1 Executive Summary

2 Introduction

2.1 Key Highlights of the Report

2.2 Report Description

2.3 Market Scope & Segmentation

2.4 Research Methodology

2.5 Assumptions

3 Nigeria Meat & Poultry Market Overview

3.1 Nigeria Country Macro Economic Indicators

3.2 Nigeria Meat & Poultry Market Revenues & Volume, 2022 & 2032F

3.3 Nigeria Meat & Poultry Market - Industry Life Cycle

3.4 Nigeria Meat & Poultry Market - Porter's Five Forces

3.5 Nigeria Meat & Poultry Market Revenues & Volume Share, By Poultry Type, 2022 & 2032F

3.6 Nigeria Meat & Poultry Market Revenues & Volume Share, By Meat Type, 2022 & 2032F

3.7 Nigeria Meat & Poultry Market Revenues & Volume Share, By End-Users, 2022 & 2032F

4 Nigeria Meat & Poultry Market Dynamics

4.1 Impact Analysis

4.2 Market Drivers

4.3 Market Restraints

5 Nigeria Meat & Poultry Market Trends

6 Nigeria Meat & Poultry Market, By Types

6.1 Nigeria Meat & Poultry Market, By Poultry Type

6.1.1 Overview and Analysis

6.1.2 Nigeria Meat & Poultry Market Revenues & Volume, By Poultry Type, 2022-2032F

6.1.3 Nigeria Meat & Poultry Market Revenues & Volume, By Chicken, 2022-2032F

6.1.4 Nigeria Meat & Poultry Market Revenues & Volume, By Turkey, 2022-2032F

6.1.5 Nigeria Meat & Poultry Market Revenues & Volume, By Ducks , 2022-2032F

6.1.6 Nigeria Meat & Poultry Market Revenues & Volume, By Others, 2022-2032F

6.2 Nigeria Meat & Poultry Market, By Meat Type

6.2.1 Overview and Analysis

6.2.2 Nigeria Meat & Poultry Market Revenues & Volume, By Pork, 2022-2032F

6.2.3 Nigeria Meat & Poultry Market Revenues & Volume, By Mutton, 2022-2032F

6.2.4 Nigeria Meat & Poultry Market Revenues & Volume, By Processed Beef, 2022-2032F

6.2.5 Nigeria Meat & Poultry Market Revenues & Volume, By Others, 2022-2032F

6.3 Nigeria Meat & Poultry Market, By End-Users

6.3.1 Overview and Analysis

6.3.2 Nigeria Meat & Poultry Market Revenues & Volume, By Retail, 2022-2032F

6.3.3 Nigeria Meat & Poultry Market Revenues & Volume, By Food-Services, 2022-2032F

7 Nigeria Meat & Poultry Market Import-Export Trade Statistics

7.1 Nigeria Meat & Poultry Market Export to Major Countries

7.2 Nigeria Meat & Poultry Market Imports from Major Countries

8 Nigeria Meat & Poultry Market Key Performance Indicators

9 Nigeria Meat & Poultry Market - Opportunity Assessment

9.1 Nigeria Meat & Poultry Market Opportunity Assessment, By Poultry Type, 2022 & 2032F

9.2 Nigeria Meat & Poultry Market Opportunity Assessment, By Meat Type, 2022 & 2032F

9.3 Nigeria Meat & Poultry Market Opportunity Assessment, By End-Users, 2022 & 2032F

10 Nigeria Meat & Poultry Market - Competitive Landscape

10.1 Nigeria Meat & Poultry Market Revenue Share, By Companies, 2025

10.2 Nigeria Meat & Poultry Market Competitive Benchmarking, By Operating and Technical Parameters

11 Company Profiles

12 Recommendations

13 Disclaimer

Global Go To Market Strategy - 2030

Export potential enables firms to identify high-growth global markets with greater confidence by combining advanced trade intelligence with a structured quantitative methodology. The framework analyzes emerging demand trends and country-level import patterns while integrating macroeconomic and trade datasets such as GDP and population forecasts, bilateral import–export flows, tariff structures, elasticity differentials between developed and developing economies, geographic distance, and import demand projections. Using weighted trade values from 2020–2024 as the base period to project country-to-country export potential for 2030, these inputs are operationalized through calculated drivers such as gravity model parameters, tariff impact factors, and projected GDP per-capita growth. Through an analysis of hidden potentials, demand hotspots, and market conditions that are most favorable to success, this method enables firms to focus on target countries, maximize returns, and global expansion with data, backed by accuracy.

By factoring in the projected importer demand gap that is currently unmet and could be potential opportunity, it identifies the potential for the Exporter (Country) among 190 countries, against the general trade analysis, which identifies the biggest importer or exporter.

To discover high-growth global markets and optimize your business strategy:

Click Here
Pricing
  • Single User License
    $ 1,995
  • Department License
    $ 2,400
  • Site License
    $ 3,120
  • Global License
    $ 3,795
6Wresearch Support

Any Query

Call: +91-11-4302-4305
Email us: sales@6wresearch.com
Any Query? Click Here

Leadership Perspectives from Industry Events

Thought Leadership and Analyst Meet

Our Clients

Airtel
Canon
Contec
HoneyWell
Kriloskar
Pwc Logo
Samsung
Tata Teleservices

Industry Events and Analyst Meet

Whitepaper

Read All